GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Notify me when product is back in stock
Howa 1500 Carbon Fibre MDT SRX 6.5 creedmoor
Howa 1500 Carbon Fibre MDT SRX 6.5 creedmoorHowa 1500 Carbon Fibre MDT SRX 6.5 creedmoorHowa 1500 Carbon Fibre MDT SRX 6.5 creedmoorHowa 1500 Carbon Fibre MDT SRX 6.5 creedmoorHowa 1500 Carbon Fibre MDT SRX 6.5 creedmoor
Howa 1500 Carbon Fibre MDT SRX 6.5 creedmoor
£1,495.00 inc. tax
£1,245.83 ex. tax
? Tax based on United Kingdom.
The all new stunning Howa 1500 CF mounter in the MDT SRX stock..

Price is for rifle only , including muzzle brake and rail and magazine.

Face to Face sale in store only or RFD transfer

1 of only 20 in the UK
£1,495.00 inc. tax
£1,245.83 ex. tax
? Tax based on United Kingdom.
Add to Cart
Product Code: cbbniT9
Product Condition: New
Details
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i