GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Armsan A612 12g Semi auto shotgun
Armsan A612 12g Semi auto shotgun
£449.00 inc. tax
£374.17 ex. tax
? Tax based on United Kingdom.
Armsan A612 12g Semi auto shotgun
Armsan A612 Semi Auto 12g Shotgun Black Soft Touch Synthetic Stock with Matte Finish – 28″ Barrel with Multi Chokes, 2+1 Shot Capacity. Fibre Optic Front Sight and supplied with Sling Swivel Studs and Stock Drop Spacers. Weight 6.6lbs

Instore purchase only or shipped to your nearest RFD
£449.00 inc. tax
£374.17 ex. tax
? Tax based on United Kingdom.
Add to Cart
Product Code: vZme6gx
Product Condition: New
Details
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i